PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.2624s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 292aa    MW: 33910.6 Da    PI: 6.0636
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.2624s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.92.7e-29183236154
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                          k+r++W+++LH+rF++a+++LGG+++AtPk+i+elmkv+gLt+e+vkSHLQk R
  Araha.2624s0001.1.p 183 KQRRCWSSQLHRRFLNALQHLGGPHVATPKQIRELMKVDGLTNEEVKSHLQKDR 236
                          79**************************************************77 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.46180238IPR017930Myb domain
SuperFamilySSF466891.15E-13182237IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-24182236IPR009057Homeodomain-like
TIGRFAMsTIGR015574.3E-26183236IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0016036Biological Processcellular response to phosphate starvation
GO:0032107Biological Processregulation of response to nutrient levels
GO:0080022Biological Processprimary root development
GO:1901699Biological Processcellular response to nitrogen compound
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MIKKFSNMDY NQKRERCGQY IEALEEERRK IHVFQRELPL CLDLVTQAIE ACKREIPEMT  60
TDNVYGQPEC SEQTTGECGP VLEQFLTIKD SLTSNEEVDE EFDDEHGNHD PDNDSEDKNT  120
KSDWLKSVQL WNQPDHLLPK EELLQQETME TVTRDESMRK DPMVNGCQGR KREVEKDGGG  180
GRKQRRCWSS QLHRRFLNAL QHLGGPHVAT PKQIRELMKV DGLTNEEVKS HLQKDREVIV  240
KGVWSGVARR RCLLLPVIIT SRIINLFLLS LMFLWSFYTI IISFCSLHIR I*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00140DAPTransfer from AT1G13300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3673360.0AF367336.1 Arabidopsis thaliana At1g13300/T6J4_6 mRNA, complete cds.
GenBankAY1248650.0AY124865.1 Arabidopsis thaliana At1g13300/T6J4_6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002889999.11e-159myb family transcription factor
TrEMBLD7KQE41e-159D7KQE4_ARALL; Myb family transcription factor
STRINGscaffold_101490.11e-159(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135081728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13300.11e-155G2-like family protein